General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAD6I6B9",
        "id": "A0AAD6I6B9_PENCN",
        "source_organism": {
            "taxId": "5083",
            "scientificName": "Penicillium canescens",
            "fullName": "Penicillium canescens"
        },
        "name": "Serine/threonine-protein phosphatase",
        "description": [
            "Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin"
        ],
        "length": 560,
        "sequence": "MDKAIARAVHEKKPVPEIDFTLHTMEDSTQVSTMERVVKEVQAPALSTPPDDMFWSPEDPSKPNLQYLKQHLYREGRLSEEQALWIIHAGTQVLRSEPNLLEMDAPITVCGDVHGQYYDLMKLFEVGGDPSETRYLFLGDYVDRGYFSIECVLYLWALKIWYPDSLWLLRGNHECRHLTDYFTFKLECKHKYSERIYEACIESFCSLPLAAVMNKQFLCIHGGLSPELHTLEDIKSIDRFREPPTHGLMCDILWADPLEEFGQEKTGDFFIHNSVRGCSYFFSYPAACAFLEKNNLLSIIRAHEAQDAGYRMYRKTRTTGFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCTPHPYWLPNFMDVFTWSLPFVGEKITDMLIAILNTCSKEELEDDTPTSEVSPPEDSASITSPVSNDPESTEFKRRAIKNKILAIGRLSRVFQVLREQSESVTELKTAAGGRLPAGTLMLGAEGIKQAIHNFEDARKVDIQNERLPPSQEEVFQKSEESRRVALERAEHEAANDAGLATVARRISMSAGSRPSRRPRDPPKDA",
        "proteome": "UP001219568",
        "gene": "N7460_008826",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033192",
                "name": "calmodulin-dependent protein phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0097720",
                "name": "calcineurin-mediated signaling",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e949b0a1fe9e51299d6615c55240932f5c7152f8",
        "counters": {
            "domain_architectures": 234891,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 234891
        }
    }
}