GET /api/protein/UniProt/A0AAD4KKF9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAD4KKF9",
        "id": "A0AAD4KKF9_9EURO",
        "source_organism": {
            "taxId": "1131652",
            "scientificName": "Talaromyces proteolyticus",
            "fullName": "Talaromyces proteolyticus"
        },
        "name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase",
        "description": [
            "Responsible for the formation of the pyrimidine heterocycle in the thiamine biosynthesis pathway. Catalyzes the formation of hydroxymethylpyrimidine phosphate (HMP-P) from histidine and pyridoxal phosphate (PLP). The protein uses PLP and the active site histidine to form HMP-P, generating an inactive enzyme. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme"
        ],
        "length": 307,
        "sequence": "MQRFHLTATGHNINYLPQYIAERHGFFQEQGLDATFSIPQPWDGVLDDLAEGTADSALGGIWVPTMYHNRVTNYTVFAQIANRCPLALIKRGPSQDFKLADVAGATVLMKSGGGASVGLFFKMLLRENSIDPKSVDYIQDLDGVMLGNLFQGGMGDYFVTDILSARTMADRNPNVSVAMEMVSQGDVPWSVYYRETATITDEVLDKQKRFLAALAKGIDWVLQRDAESFKNELAELFPTVPVQVAVDVTNTFRHNSMWTSPLIPRGGFDRWQLGLVGARLVKDPLAYETLINDVPVLAALKAKSDQS",
        "proteome": "UP001201262",
        "gene": "BGW36DRAFT_362060",
        "go_terms": [
            {
                "identifier": "GO:0009228",
                "name": "thiamine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a7843b174854e51b1f7bf70c154a1e948dc81e7c",
        "counters": {
            "domain_architectures": 65119,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 65119
        }
    }
}