GET /api/protein/UniProt/A0AAD2YSI4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAD2YSI4",
"id": "A0AAD2YSI4_ECOLX",
"source_organism": {
"taxId": "1055536",
"scientificName": "Escherichia coli O103",
"fullName": "Escherichia coli O103"
},
"name": "Flavin prenyltransferase UbiX",
"description": [
"Flavin prenyltransferase that catalyzes the synthesis of the prenylated FMN cofactor (prenyl-FMN) for 4-hydroxy-3-polyprenylbenzoic acid decarboxylase UbiD. The prenyltransferase is metal-independent and links a dimethylallyl moiety from dimethylallyl monophosphate (DMAP) to the flavin N5 and C6 atoms of FMN"
],
"length": 189,
"sequence": "MKRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALADVTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVLCVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPEDLFARWQGA",
"proteome": null,
"gene": "ubiX",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a8d4bade61d095bea50675bf04b899cb1d7578d3",
"counters": {
"domain_architectures": 29049,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 29049
}
}
}