GET /api/protein/UniProt/A0AAD2NTE1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAD2NTE1",
"id": "A0AAD2NTE1_ECOLX",
"source_organism": {
"taxId": "217992",
"scientificName": "Escherichia coli O6",
"fullName": "Escherichia coli O6"
},
"name": "Ecotin",
"description": [
"General inhibitor of pancreatic serine proteases: inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases"
],
"length": 162,
"sequence": "MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLESKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR",
"proteome": null,
"gene": "eco",
"go_terms": [
{
"identifier": "GO:0004867",
"name": "serine-type endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "118cbe835ec8910836f5b3e5e635ea2d642c85e0",
"counters": {
"domain_architectures": 2456,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2456
}
}
}