GET /api/protein/UniProt/A0AAD0SRL9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAD0SRL9",
"id": "A0AAD0SRL9_9BACT",
"source_organism": {
"taxId": "663365",
"scientificName": "Arcobacter suis CECT 7833",
"fullName": "Arcobacter suis CECT 7833"
},
"name": "Probable oxaloacetate decarboxylase gamma chain",
"description": [
"Catalyzes the decarboxylation of oxaloacetate coupled to Na(+) translocation"
],
"length": 82,
"sequence": "MEINLVAESIKFMFLGMGVVFAFLTIMIFVLKAQGAILTRFFPEKEKIVNIVVPRSENTNNIEAAKIAAVIAAVQHHKNLKG",
"proteome": "UP000263040",
"gene": "oadG2",
"go_terms": [
{
"identifier": "GO:0015081",
"name": "sodium ion transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0036376",
"name": "sodium ion export across plasma membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c89c58ce849afbd27e3d0b46f7d78875a9d09755",
"counters": {
"domain_architectures": 5468,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5468
}
}
}