HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAC8W3P9",
"id": "A0AAC8W3P9_9PROT",
"source_organism": {
"taxId": "528244",
"scientificName": "Azospirillum thiophilum",
"fullName": "Azospirillum thiophilum"
},
"name": "Protein-glutamate methylesterase/protein-glutamine glutaminase",
"description": [
"Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid"
],
"length": 379,
"sequence": "MGRPEPTVLVVDDSALMRRRIADLLGEAGFRVETAATGEEALARLPVLDPDVVTLDITMPGMDGLACLARIMVEHPKPVVMVSALTGAGAEETLEALRLGAVEAVQKPAAGAIGRIGMELVETVRAAASSRPRRVHGLRERLRLARARIAGEDFAAPAPPSPQDAPPSPAEALGGEGVVLIGVSTGGPSTLEDILPLLPADFPWPVVVAQHMPAAFTATLARRLDELCALRVVEAARATVLEPGMVCIARGGADLELARRGGRLQAVCVPASPDRPWHPNADRLVTSALRLLPADRLVGVLLTGMGDDGGASMADLHGRGGRTIAESEDSAVIFGMPQDLIRRGGAGIVLPSNRIAGQLVRWLMPAARRPDRRPDQRTG",
"proteome": "UP000069935",
"gene": "cheB",
"go_terms": [
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000156",
"name": "phosphorelay response regulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008984",
"name": "protein-glutamate methylesterase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006935",
"name": "chemotaxis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1ffce45f4ee3456bb60a857b0469c3fdff2b4f81",
"counters": {
"domain_architectures": 17615,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"smart": 1,
"profile": 2,
"pfam": 2,
"cdd": 2,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17615
}
}
}