GET /api/protein/UniProt/A0AAC8W3P9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAC8W3P9",
        "id": "A0AAC8W3P9_9PROT",
        "source_organism": {
            "taxId": "528244",
            "scientificName": "Azospirillum thiophilum",
            "fullName": "Azospirillum thiophilum"
        },
        "name": "Protein-glutamate methylesterase/protein-glutamine glutaminase",
        "description": [
            "Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid"
        ],
        "length": 379,
        "sequence": "MGRPEPTVLVVDDSALMRRRIADLLGEAGFRVETAATGEEALARLPVLDPDVVTLDITMPGMDGLACLARIMVEHPKPVVMVSALTGAGAEETLEALRLGAVEAVQKPAAGAIGRIGMELVETVRAAASSRPRRVHGLRERLRLARARIAGEDFAAPAPPSPQDAPPSPAEALGGEGVVLIGVSTGGPSTLEDILPLLPADFPWPVVVAQHMPAAFTATLARRLDELCALRVVEAARATVLEPGMVCIARGGADLELARRGGRLQAVCVPASPDRPWHPNADRLVTSALRLLPADRLVGVLLTGMGDDGGASMADLHGRGGRTIAESEDSAVIFGMPQDLIRRGGAGIVLPSNRIAGQLVRWLMPAARRPDRRPDQRTG",
        "proteome": "UP000069935",
        "gene": "cheB",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000156",
                "name": "phosphorelay response regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008984",
                "name": "protein-glutamate methylesterase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006935",
                "name": "chemotaxis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1ffce45f4ee3456bb60a857b0469c3fdff2b4f81",
        "counters": {
            "domain_architectures": 17615,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "smart": 1,
                "profile": 2,
                "pfam": 2,
                "cdd": 2,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17615
        }
    }
}