GET /api/protein/UniProt/A0AAA9SUN1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAA9SUN1",
"id": "A0AAA9SUN1_BOVIN",
"source_organism": {
"taxId": "9913",
"scientificName": "Bos taurus",
"fullName": "Bos taurus (Bovine)"
},
"name": "Transcription termination factor 3, mitochondrial",
"description": [
"Binds promoter DNA and regulates initiation of transcription. Required for normal mitochondrial transcription and translation, and for normal assembly of mitochondrial respiratory complexes. Required for normal mitochondrial function. Maintains 16S rRNA levels and functions in mitochondrial ribosome assembly by regulating the biogenesis of the 39S ribosomal subunit"
],
"length": 464,
"sequence": "MPNIKQAEIQYAAAAKPLQSCPTLCDPIDGSPPGSAVPGILQATLRKMALSAQQIPRWLNSVKLSSFMTALQLRKGFQRPGKTLLCGVFAQPHASSEDCFLQWGFRTYRTSSMWNSSQSANSSRREINCAQSTLLPSVNEPPQKTQKMPGLDSELSLEGLDDVPPLSPLQPISDEEAVQIIAGPPLPPSSVTLRDYVDHSETLRKLVLLGVDLSKIEKHPDAANLLLRLDFEKDIKQMLLLLKDLGIEDTQLGPFLTKNYAIFSEDLENLKTRVAYLQSKNFSKADIAQMVRNAPFLLSFSAERLDNRLGFFQKELKLSVKKTRDLVIRLPRLLTGSLEPVKENMKVFQLELGFQQNEIQHMITKIPKMLTANKRKLTETFDYVHNVMRVPHHVIVRFPQVFNTRLFKVKERHLFLAYLGRAQYDPTEPNYISLDKLVSVPDGIFCEGMAKASIQDFEKFLKTL",
"proteome": "UP000009136",
"gene": "MTERF3",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043231",
"name": "intracellular membrane-bounded organelle",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "322ef6fa1be40fd07a4262217bcc7cf72ef20667",
"counters": {
"domain_architectures": 19771,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19771
}
}
}