GET /api/protein/UniProt/A0AA97PKY2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA97PKY2",
"id": "A0AA97PKY2_PYRO3",
"source_organism": {
"taxId": "1143189",
"scientificName": "Pyricularia oryzae (strain Y34)",
"fullName": "Pyricularia oryzae (strain Y34) (Rice blast fungus)"
},
"name": "1,3-beta-glucanosyltransferase",
"description": [
"Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall"
],
"length": 485,
"sequence": "MLVKSSLLALGAASIAAAVKPVVVKDNHFVNPENGSRFHIIGVAYQPGGSAGYKPESGIDPLSNADVCLRDAALIQSLGANAIRVYNLNPNLNHDECASIFNAAGIYMVLDVNSPLVGESITSHNPWESYYGSYVNRTLAVVEAFKDYPNTLAFFSGNEVIANVDTGATVPPYIRAVTRDLKNYIAKHSKRPIPVGYSAADVRSVLFDSFEYFQCAIDGKSDDMSRADLFALNSYSWCGDSSFTKSGYDQLVAGFKGTSVPVFFSEYGCNTPSPRIFTEVGAIYGDQMNTVFSGGVVYEYVQEPNNFGLVEINNDGSVTVLDDYFTLKDQIAKLDFKKVQGVSAAAGQSAAPPKCDTGLIKEKGFNNNFTLPVPPPGVPEMLQDGIKPAPVGKLVDIKSWKVTHPIKTKAGKSIDGLEVKKLANDAINQPGSNSGTGSGTPSSGASAGGASASPDKKDAAGNVRVGFATVFVSAAAAAACAVFVF",
"proteome": null,
"gene": "OOU_Y34scaffold00534g11",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9be63055f980b6c6f0d373e34596ce959420a0ce",
"counters": {
"domain_architectures": 4786,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4786
}
}
}