General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA96ZTR6",
        "id": "A0AA96ZTR6_9EURY",
        "source_organism": {
            "taxId": "3028295",
            "scientificName": "Methanimicrococcus hongohii",
            "fullName": "Methanimicrococcus hongohii"
        },
        "name": "Diadenylate cyclase",
        "description": [
            "Diadenylate cyclase that catalyzes the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP is a second messenger for intracellular signal transduction involved in the control of important regulatory processes such as osmoregulation"
        ],
        "length": 331,
        "sequence": "MEEVTEKQEVKTALENPIFNASASDDLCGILLKDSVRHLAKLTEAVAVFTFGNIDTKSFKDLDIPVIDITQIKTIIEKLTYLRNENQFQIQEVSESIKTEADKNASLLMSAAAVEYSLGTIPCGIVLGLIRTQNSYSLVVHSMEENETVQTVRECEKRVTPETFRNVLHLSLNIAMKGREGKKVGTAFVLGDEEEVLERSHQMIINPFRGQDSEININKKETWETVMGFAQLDGVFIISETGKILSAGRYLDVDTRDIHIEKGLGTRHLSSASITRDTNAIAVAISESGGTIRVYMDGKEVVYVEPGASLVVVEGDGSLRTAKPVSELPLD",
        "proteome": "UP001302978",
        "gene": "dacA",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "063f8d78754eafe604098fc223c798db321111c6",
        "counters": {
            "domain_architectures": 127,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 127
        }
    }
}