GET /api/protein/UniProt/A0AA96WZ58/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA96WZ58",
        "id": "A0AA96WZ58_9CYAN",
        "source_organism": {
            "taxId": "2547451",
            "scientificName": "Leptolyngbya sp. NK1-12",
            "fullName": "Leptolyngbya sp. NK1-12"
        },
        "name": "Photosystem II protein D1",
        "description": [
            "Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors"
        ],
        "length": 362,
        "sequence": "MTTLLQRRGARVQWEQFCNWVTSTENRLYVGWFGVLMIPLLLVSACVFTIAFIAAPPVDIDGIREPIAGSLIYGNNIITAAVVPSSNAIGLHFYPIWEAASIDEWLYNGGPYQMIAAHYVPALCCYMGREWELSYRLGMRPWIAVAYSAPLAATVSVFLIYPIGQGSFSDGLPMGISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFCAMHGSLVTSSLVRETTENESQNYGYKFGQEGETYNIVAAHGYFGRLVFQYASFTNSRSLHFFLAAFPVICIWATALGISTMAFNLNGFNFNHSVLDSQGRVVNTWADVLNRANLGFEVMHERNAHNFPLDLAGGEAVPVAMNMAAPVLPS",
        "proteome": null,
        "gene": "psbA",
        "go_terms": [
            {
                "identifier": "GO:0009772",
                "name": "photosynthetic electron transport in photosystem II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019684",
                "name": "photosynthesis, light reaction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73c30af4df54cc5ea0296573b55812fd28876e62",
        "counters": {
            "domain_architectures": 46410,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 46410
        }
    }
}