General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA96VEP7",
        "id": "A0AA96VEP7_9STRE",
        "source_organism": {
            "taxId": "3028083",
            "scientificName": "Streptococcus iners subsp. hyiners",
            "fullName": "Streptococcus iners subsp. hyiners"
        },
        "name": "tRNA dimethylallyltransferase",
        "description": [
            "Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A)"
        ],
        "length": 294,
        "sequence": "MKTKVIVVIGPTAVGKTALGIDLAQRYNGEIISGDSQQVYRKLDIGTAKASPEEQAAAVHHLIDVRDVTEGYSAYEFVAEARALIADIKSRGKLPIIVGGTGLYIQSLLEGYHLGGLVDQEQVLAYRAELDCLSDEDLETMAEQVGLTIEGNSRRRIIRGLELKKFGKNLENTESGYEPLYICLTDDRQVLYDRINQRVDKMMAAGLLDEVSWLYQEHPQAQAAMGIGYKEFFPYFAGELSLEEAVDKVKQNSRRFAKRQLTWFRNRMQVPFYSVGEPDYKSQIFTAVEEFLND",
        "proteome": "UP001301526",
        "gene": "miaA",
        "go_terms": [
            {
                "identifier": "GO:0052381",
                "name": "tRNA dimethylallyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0384e64f9f7c69c3c37e403c75a6e4cde76f3bc",
        "counters": {
            "domain_architectures": 32144,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32144
        }
    }
}