General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA96VB89",
        "id": "A0AA96VB89_9EURY",
        "source_organism": {
            "taxId": "3028294",
            "scientificName": "Methanimicrococcus stummii",
            "fullName": "Methanimicrococcus stummii"
        },
        "name": "Digeranylgeranylglycerophospholipid reductase",
        "description": [
            "Is involved in the reduction of 2,3-digeranylgeranylglycerophospholipids (unsaturated archaeols) into 2,3-diphytanylglycerophospholipids (saturated archaeols) in the biosynthesis of archaeal membrane lipids. Catalyzes the formation of archaetidic acid (2,3-di-O-phytanyl-sn-glyceryl phosphate) from 2,3-di-O-geranylgeranylglyceryl phosphate (DGGGP) via the hydrogenation of each double bond of the isoprenoid chains. Is also probably able to reduce double bonds of geranyl groups in CDP-2,3-bis-O-(geranylgeranyl)-sn-glycerol and archaetidylserine, thus acting at various stages in the biosynthesis of archaeal membrane lipids"
        ],
        "length": 406,
        "sequence": "MKNEYDVIVIGAGPAGSIAAKTAAIRGCSVLLIEKRPEIGVPVRCAEGTSKTELMKFVDIDPAFICNELHAAVVHAPNGTSFSVTTNMSGIDSEAGIILDRKIFDRHLAKLAADAGADVYTKTAATGLIIEEINNEEKTVAGVVLNHLGEEIRIRSKIVIAADGIESKIARMAGIDTTLKLNDIESGVQFLIYDESIRPAECEIFLGNEIAPGGYIWVFPKGNNTANVGIGISKNRNGKKAIDYLESFMSEKFPNAKILGTFFGGVPVSGGLEKITANGLMLAGDAARQTDPITGAGIRYATYAGEMAGRTAAEAIAAGDCSDKFLKKYQTEWDQTLGKTIKRNYKIKKAYDSWTDEEMNHIAKMAAALPLEDFELKEAIVAVLKSDKKLMWKMKGVYYDLLKSLI",
        "proteome": "UP001302662",
        "gene": "thi4_2",
        "go_terms": [
            {
                "identifier": "GO:0016628",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045550",
                "name": "geranylgeranyl reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008610",
                "name": "lipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d52031dc2d878f33b45072ae36b9b2939949a85c",
        "counters": {
            "domain_architectures": 623,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 623
        }
    }
}