HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA94L307",
"id": "A0AA94L307_DESDE",
"source_organism": {
"taxId": "876",
"scientificName": "Desulfovibrio desulfuricans",
"fullName": "Desulfovibrio desulfuricans"
},
"name": "DNA repair protein RadA",
"description": [
"DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand transfer reactions, allowing the 3' invading strand to extend heteroduplex DNA faster. Binds ssDNA in the presence of ADP but not other nucleotides, has ATPase activity that is stimulated by ssDNA and various branched DNA structures, but inhibited by SSB. Does not have RecA's homology-searching function",
"Plays a role in repairing double-strand DNA breaks, probably involving stabilizing or processing branched DNA or blocked replication forks"
],
"length": 458,
"sequence": "MAKLREIYICSSCGAQTMQWRGQCPGCHEWNTLEASVQARSSGKTRTSLGDSSASGRPVALCQVEDAGHEPYGSGLQALDRVLGKGLVPGAAILVGGEPGIGKSTLLLQVAGLVAAQMASAGRPVLYASGEESLPQIKGRAERLGMLDPNLLALATSRVEDVVEAANAQNPALLVVDSVQTLTSLEAEGLPGNVSQVRAVATSLLELCRRLGCTLILVGHVTKDGVLAGPRLLEHMVDTVISLEGDRRQMFRLLRVFKNRFGPNEELLVFRMGQRGMEVVDDPSTFFLGQRDASLSGTAVVMAVDGQRPLAVEVQALVSRTFLSIPRRAALGFDVGRLHLLLAVLEKRLKLNFAQVDIYAKVGGGMKLNEPGLDLALVAAVLSSYYDVPLPEKSVLWGEVDLNGQVRPVAAQDLRLTQARRLGFDPIVHPGDEKGGIATIAALQQRLFHRRHKAEDGE",
"proteome": null,
"gene": "radA",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0140664",
"name": "ATP-dependent DNA damage sensor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003684",
"name": "damaged DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9da3eed053dfc05f0833bc6077316e7abdc10e1f",
"counters": {
"domain_architectures": 2678,
"entries": 20,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 1,
"cathgene3d": 2,
"profile": 1,
"ssf": 2,
"smart": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"prints": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2678
}
}
}