General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA94HRH2",
        "id": "A0AA94HRH2_DESDE",
        "source_organism": {
            "taxId": "876",
            "scientificName": "Desulfovibrio desulfuricans",
            "fullName": "Desulfovibrio desulfuricans"
        },
        "name": "RNA polymerase-binding transcription factor DksA",
        "description": [
            "Transcription factor that acts by binding directly to the RNA polymerase (RNAP). Required for negative regulation of rRNA expression and positive regulation of several amino acid biosynthesis promoters"
        ],
        "length": 120,
        "sequence": "MDHKDLEYFRKLLSGMLEEAQQKGDSTIEELTDSNEVFADPADRATAESDRAFTLRIRDRERRLIRKIQAALTRIDDGTYGICEDCGDDISIPRLKARPVTRLCINCKAKQEEDEHLRGD",
        "proteome": null,
        "gene": "dksA",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d82a727f4c8057974f0fbd75da7dd8cbf42afb9b",
        "counters": {
            "domain_architectures": 10481,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 1,
                "pfam": 2,
                "profile": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10481
        }
    }
}