GET /api/protein/UniProt/A0AA88ZUZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA88ZUZ5",
        "id": "A0AA88ZUZ5_CLONO",
        "source_organism": {
            "taxId": "1444290",
            "scientificName": "Clostridium novyi A str. 4570",
            "fullName": "Clostridium novyi A str. 4570"
        },
        "name": "Cell division topological specificity factor",
        "description": [
            "Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell"
        ],
        "length": 88,
        "sequence": "MDLFKLFSGKPSSKEVAKDRLKLILIHDRSSIAPELLEVMKSDILKVISKYVIIDDDEVEVRLTKTEEVDASSPALIASIPIKKMKQR",
        "proteome": null,
        "gene": "minE",
        "go_terms": [
            {
                "identifier": "GO:0032955",
                "name": "regulation of division septum assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051301",
                "name": "cell division",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "01e5d2c26e11b4c210bf165d19f1754db1b574c8",
        "counters": {
            "domain_architectures": 9070,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9070
        }
    }
}