GET /api/protein/UniProt/A0AA88NE46/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA88NE46",
"id": "A0AA88NE46_TACVA",
"source_organism": {
"taxId": "175792",
"scientificName": "Tachysurus vachellii",
"fullName": "Tachysurus vachellii (Darkbarbel catfish)"
},
"name": "Proteasome inhibitor PI31 subunit",
"description": [
"Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28"
],
"length": 270,
"sequence": "MAGLEVLYTCVASSISSPQDAVVCFIHWEIVKSGYKCLGSGDEPLNGEKKSELLPASWNTNKELYTLRYRSNDDKSNLLLKAITADSSLIFNLMDSASDKVTDLTINVSDYVNEANLQSFESVYKNTGDLAKRLNSSLLPAVKDQGSVMKERKERFTDTQPKPDHDPLCVPTRHTPASYPPNWTDPFNPFAAGRADLDPFSGTTEGMIVDPLRAGFPRSGFDPSSGIPGVLPPGAVPPGARFDPFGPVGRHRAGPDPDHLPRPGYDDMFM",
"proteome": "UP001187315",
"gene": "Q7C36_005634",
"go_terms": [
{
"identifier": "GO:0004866",
"name": "endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0070628",
"name": "proteasome binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043161",
"name": "proteasome-mediated ubiquitin-dependent protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "450cad30097e48cf3cf690143401afdb4d19a1dd",
"counters": {
"domain_architectures": 2556,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2556
}
}
}