General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA86YEU2",
        "id": "A0AA86YEU2_PROST",
        "source_organism": {
            "taxId": "471874",
            "scientificName": "Providencia stuartii ATCC 25827",
            "fullName": "Providencia stuartii ATCC 25827"
        },
        "name": "4-hydroxyphenylacetate 3-monooxygenase reductase component",
        "description": [
            "Catalyzes the reduction of free flavins (FMN, FAD and riboflavin) by NADH. Subsequently, the reduced flavins diffuse to the large HpaB component or to other electron acceptors such as cytochrome c and Fe(3+) ion"
        ],
        "length": 172,
        "sequence": "MSLENEHRLRFRDAMASLGAAVNIVTTDGTAGCCGITATAVCSVTDTPPTLMVCVNRNSAMNAVFQENGRLCVNILNHEQEEMACHFAGMKGSTMEERFAWSIWDKGILQQPLLKDALANLEGEITQVQDIGTHSVYLVEMKQIIVREEGHGLIYFKRKFHPVMHQTLAVTA",
        "proteome": null,
        "gene": "hpaC",
        "go_terms": [
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042537",
                "name": "benzene-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "99d29f89f917a11644ac2fc4bedf5a173bd13b02",
        "counters": {
            "domain_architectures": 63683,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 63683
        }
    }
}