GET /api/protein/UniProt/A0AA86GMM4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA86GMM4",
        "id": "A0AA86GMM4_9SPHN",
        "source_organism": {
            "taxId": "267128",
            "scientificName": "Sphingopyxis granuli",
            "fullName": "Sphingopyxis granuli"
        },
        "name": "S-adenosylmethionine synthase",
        "description": [
            "Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme"
        ],
        "length": 408,
        "sequence": "MRNSFLFTSESVSEGHPDKVADQISDSIVDLFLSKDPEARVACETLTTTQLVVLAGEIRCKGVYEDGEWAPGALDEIEATVRETVREIGYEQDGFHWKNLRFENNLHGQSAHIAQGVDESADKDEGAGDQGIMFGYASDETPDLMPATLDYAHKILERMAADRKAGIAPFLEPDTKSQVTLRYANERPVEATAIVVSTQHAPGYFWHDGEGDETKYQELRKYVLGVIADVLPAELLTANTVYHINPTGRFEIGGPDGDAGLTGRKIIVDTYGGASPHGGGAFSGKDPTKVDRSAAYITRYLAKNVVAAGLARRCTIQLSYAIGVAEPLSVYVDLHGTAAEGVSEAALEQALPQLVRLTPKGIRTHLGLNKPIYRQTAAYGHFGRQPDGDAFPWERTDLIDRLKAALGR",
        "proteome": "UP000058599",
        "gene": "metK",
        "go_terms": [
            {
                "identifier": "GO:0004478",
                "name": "methionine adenosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006556",
                "name": "S-adenosylmethionine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "19eaff5c12f42b31629adc7742ec6ffb3fe068a7",
        "counters": {
            "domain_architectures": 35253,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 3,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 35253
        }
    }
}