General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA51UM54",
        "id": "A0AA51UM54_9EURY",
        "source_organism": {
            "taxId": "3072978",
            "scientificName": "Methanolobus sediminis",
            "fullName": "Methanolobus sediminis"
        },
        "name": "Bifunctional enzyme Fae/Hps",
        "description": [
            "Catalyzes the condensation of formaldehyde with tetrahydromethanopterin (H(4)MPT) to 5,10-methylenetetrahydromethanopterin",
            "Catalyzes the reversible formation of ribulose-5-phosphate and formaldehyde from 3-hexulose-6-phosphate"
        ],
        "length": 392,
        "sequence": "MLLIGEALIGEEPELAHVDLMIGNKDGPVGQAFANGLTQLSAGHTPLLSVIRPNLPTKPATLIVPKVTVKNMGQAAQIFGPAQAAVAKAVADALEEGAFGDLDPEDLVVVASVFIHPEATDYNRIYRYNYGATKLAVKRAVDGFPDIDTVLKEKDRMGHAIMGFKVSRLWNPPYLQVALDNPNLPVIQNIVKQIPKSDHVILEAGTPLIKRYGVDVISKLREIRPDAFIVADLKTLDTGNLEARMVADATADAIVVSALAPIATMNKAIEEAHKTGIYAIMDTLNCDDPVAVLKQLDVLPDVVELHRGIDIEETEHAWGNIDAIKALSPKILVAVAGGVRIDTMPAALKAGADVLVVGRAITNAKDVRQVAEKFIEGLNNPEIDQFRVMTDF",
        "proteome": "UP001182908",
        "gene": "fae-hps",
        "go_terms": [
            {
                "identifier": "GO:0016840",
                "name": "carbon-nitrogen lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016051",
                "name": "carbohydrate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004590",
                "name": "orotidine-5'-phosphate decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016832",
                "name": "aldehyde-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "664230110fea74fe6fa2581ed904a9685ba0e5e1",
        "counters": {
            "domain_architectures": 244,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "smart": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 244
        }
    }
}