GET /api/protein/UniProt/A0AA51RWS1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA51RWS1",
"id": "A0AA51RWS1_9GAMM",
"source_organism": {
"taxId": "3070815",
"scientificName": "Pleionea litopenaei",
"fullName": "Pleionea litopenaei"
},
"name": "Single-stranded DNA-binding protein",
"description": [
"Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism"
],
"length": 180,
"sequence": "MASRGINKVILVGNLGNDPEIRYTANGGAIANLSIATSEQWKDRNSGEMREKTEWHRVVIFGKLAEIAGEYLRKGSQVYLEGKLQTRKWQDQQGQDKYTTEVIVDINGVMQMLGGGAGGRSGGDNYQQQSSQQNYGQQQNYGQQGQQNQGGFNQNQGGGQQSAPQQDSGFSDNFDDDIPF",
"proteome": "UP001239782",
"gene": "ssb",
"go_terms": [
{
"identifier": "GO:0003697",
"name": "single-stranded DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f1fb2be8363e3a291867f69be613915a57077a1b",
"counters": {
"domain_architectures": 57966,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 57966
}
}
}