GET /api/protein/UniProt/A0AA51RTC7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA51RTC7",
"id": "A0AA51RTC7_9GAMM",
"source_organism": {
"taxId": "3070815",
"scientificName": "Pleionea litopenaei",
"fullName": "Pleionea litopenaei"
},
"name": "3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC",
"description": [
"Catalyzes the hydrolysis of 3-deoxy-D-manno-octulosonate 8-phosphate (KDO 8-P) to 3-deoxy-D-manno-octulosonate (KDO) and inorganic phosphate"
],
"length": 181,
"sequence": "MSNQDYSSELLSRAAKIQLLIMDVDGVLSDGKVYYTNGGEEIKNFNIKDGLGIKLLHQNHIKTAIITGRQSDIVARRAAELGITSVFQGKSNKRDAFQQLLEQHQLEPSQVAHVGDDLPDLPLMQLAGLGIAVSDANWFVKHNADWTTPSAGGQGAVRDIAELLLSSRNLLEQVYQDYLTP",
"proteome": "UP001239782",
"gene": "Q9312_18080",
"go_terms": [
{
"identifier": "GO:0016788",
"name": "hydrolase activity, acting on ester bonds",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "939addaa363fbd6b350af4a2a44bd70a0647b29d",
"counters": {
"domain_architectures": 78362,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"sfld": 3,
"panther": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 78362
}
}
}