HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA50NHP7",
"id": "A0AA50NHP7_9NEOP",
"source_organism": {
"taxId": "2847589",
"scientificName": "Maurus vogelii vogelii",
"fullName": "Maurus vogelii vogelii"
},
"name": "3',5'-cyclic-AMP phosphodiesterase",
"description": [
"Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. Vital for female fertility. Required for learning/memory"
],
"length": 351,
"sequence": "TLTHTNSFTGERVPRYGVETPHEEELGGLLGELDRWGIDIFRVGDLSGGRPLTAVAYAAFTSRELLATLQIPPRTFLAFAVTLEEHYIRDNPFHNSLHAADVAQSTHVLLNTAALDAVFTPIEVCAALFAACVHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNDGCDIFVNLHKKQRQTLRKMVIDMVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVSLLMEEFFQQGDREREQGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQSMIPPSPPPA",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004114",
"name": "3',5'-cyclic-nucleotide phosphodiesterase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008081",
"name": "phosphoric diester hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "55c76fe585d3fb9c71ce12a59464e90a49687b13",
"counters": {
"domain_architectures": 20360,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 20360
}
}
}