GET /api/protein/UniProt/A0AA50JAV7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA50JAV7",
        "id": "A0AA50JAV7_9NEOP",
        "source_organism": {
            "taxId": "2847894",
            "scientificName": "Harpendyreus juno",
            "fullName": "Harpendyreus juno"
        },
        "name": "GTP-binding nuclear protein",
        "description": [
            "GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle"
        ],
        "length": 137,
        "sequence": "MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKRYVATLGVEVHPLVFHTNRGPIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKVKAKTIVFHRKKNL",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006913",
                "name": "nucleocytoplasmic transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
        "counters": {
            "domain_architectures": 273930,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 4,
                "cathgene3d": 1,
                "profile": 2,
                "ncbifam": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 273930
        }
    }
}