GET /api/protein/UniProt/A0AA50J527/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA50J527",
        "id": "A0AA50J527_9NEOP",
        "source_organism": {
            "taxId": "2847427",
            "scientificName": "Cigaritis trimeni",
            "fullName": "Cigaritis trimeni"
        },
        "name": "Proteasomal ubiquitin receptor ADRM1 homolog",
        "description": [
            "May function as a proteasomal ubiquitin receptor. May promote the deubiquitinating activity associated with the 26S proteasome"
        ],
        "length": 107,
        "sequence": "ATALFGNTSGLGGSSGGSKHLVEFRAGRMTLKGRMVHPDKRKGLLYVYQGEDSLMHFCWKDRTTGEVEDDLLIFPDDCEFVRVNECTTGRVYVLKFKSFSKKYFFWM",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c47ce0ef9fe71c2701ce2cf166ca817ab7b003e8",
        "counters": {
            "domain_architectures": 2340,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2340
        }
    }
}