General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA50FR00",
        "id": "A0AA50FR00_9NEOP",
        "source_organism": {
            "taxId": "1904819",
            "scientificName": "Zethera pimplea",
            "fullName": "Zethera pimplea"
        },
        "name": "Holocytochrome c-type synthase",
        "description": [
            "Lyase that catalyzes the covalent linking of the heme group to the cytochrome C apoprotein to produce the mature functional cytochrome"
        ],
        "length": 78,
        "sequence": "MPPANQQPAPDQPFTLPTNRQVSSIPRAMPDGSTEFWVYPSQQMFWNAMLRKGWRWKDEDIKQKDMEDIIRIHNANNE",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004408",
                "name": "holocytochrome-c synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7a0cce2127ab094022d941a9eb6800392f82bb92",
        "counters": {
            "domain_architectures": 6131,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6131
        }
    }
}