GET /api/protein/UniProt/A0AA50FR00/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA50FR00",
"id": "A0AA50FR00_9NEOP",
"source_organism": {
"taxId": "1904819",
"scientificName": "Zethera pimplea",
"fullName": "Zethera pimplea"
},
"name": "Holocytochrome c-type synthase",
"description": [
"Lyase that catalyzes the covalent linking of the heme group to the cytochrome C apoprotein to produce the mature functional cytochrome"
],
"length": 78,
"sequence": "MPPANQQPAPDQPFTLPTNRQVSSIPRAMPDGSTEFWVYPSQQMFWNAMLRKGWRWKDEDIKQKDMEDIIRIHNANNE",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004408",
"name": "holocytochrome-c synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005739",
"name": "mitochondrion",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7a0cce2127ab094022d941a9eb6800392f82bb92",
"counters": {
"domain_architectures": 6131,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6131
}
}
}