General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA41MK42",
        "id": "A0AA41MK42_SCICA",
        "source_organism": {
            "taxId": "30640",
            "scientificName": "Sciurus carolinensis",
            "fullName": "Sciurus carolinensis (Eastern gray squirrel)"
        },
        "name": "Bis(5'-adenosyl)-triphosphatase ENPP4",
        "description": [
            "Hydrolyzes extracellular Ap3A into AMP and ADP, and Ap4A into AMP and ATP. Ap3A and Ap4A are diadenosine polyphosphates thought to induce proliferation of vascular smooth muscle cells. Acts as a procoagulant, mediating platelet aggregation at the site of nascent thrombus via release of ADP from Ap3A and activation of ADP receptors"
        ],
        "length": 453,
        "sequence": "MKLLVILFFSGLMTGCRGNSSYSVPPKLLLVSFDGFRADYLQNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDVVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVLIHNTTPSYFMNYSISVSFEERLNNITMWLSNSNPPVTFATLYWEEPDASGHKYGPEDKENMRRVLKEIDDLIGYLVQKLKMLGLWENLNVIITSDHGMTQCSENRMINLDLCIDRSTYTLIDLTPVAAVLPKINITEVYDKLKNCSPHMNVYLKEDIPDRFYYQHNDRIQPIILVADEGWTIVLNKSLSKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFSHTKCLLVDQWCINLPEAIGIVIGVLLVLTTLTCLIIIMQNRLSVPHPFSRLQLQEDDDDPLIG",
        "proteome": "UP001166674",
        "gene": "SUZIE_122870",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "74303254b231460c01e998a8e55327bf5058fe75",
        "counters": {
            "domain_architectures": 41960,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 41960
        }
    }
}