HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA37S1V9",
"id": "A0AA37S1V9_9GAMM",
"source_organism": {
"taxId": "1315271",
"scientificName": "Pseudoalteromonas tetraodonis GFC",
"fullName": "Pseudoalteromonas tetraodonis GFC"
},
"name": "dITP/XTP pyrophosphatase",
"description": [
"Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions"
],
"length": 199,
"sequence": "MTNTLVLATGNPGKVNELANMLSSLNINVVPQSDFNVSDVAETGTTFVENAIIKARHAAKITGLPAIADDSGLEVDSLNGAPGVYSARFAGKGASDQDNIDKLLADLGDNPNRRARFWCVLVLMRHADDPTPLICSASWEGEITLSQHGEGGFGYDPIFFVPSENCTSAELTKAQKNALSHRGQALKMLLQELQHKGGL",
"proteome": "UP001161408",
"gene": "rdgB",
"go_terms": [
{
"identifier": "GO:0047429",
"name": "nucleoside triphosphate diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009143",
"name": "nucleoside triphosphate catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0017111",
"name": "ribonucleoside triphosphate phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "029a777975285995c6aff1e90978714c8929fb21",
"counters": {
"domain_architectures": 32111,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32111
}
}
}