GET /api/protein/UniProt/A0A9Y3VJV7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Y3VJV7",
"id": "A0A9Y3VJV7_9CICH",
"source_organism": {
"taxId": "303518",
"scientificName": "Pundamilia nyererei",
"fullName": "Pundamilia nyererei"
},
"name": "Mitochondrial import inner membrane translocase subunit TIM50",
"description": [
"Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane"
],
"length": 362,
"sequence": "MSAVCVLPMCLRASRGLLRLRSAAAGASAPAMVDVIRTLSTDKPPAAAGSATGGLAQAILQERLQQQQQPTQGQPPPEGGEGEREGEKAEDRKQKENTAYAKKMVLRLAGFMGVGGAVAIVYIFGTNSVDEQGNTIPDEFDKDPPVIQQLRRTYKYFKDYRQMIIEPTSPKLLPDPLKEPYYQPPYTLVLELTDVLLHPEWSLATGWRFKKRPGIDYLFQQVAPLYEIVVFTAETGMTAYPLIDSIDPQGFVMYRLFRDATRYVEGHHIKVCALKKWDGNSEDRTLYDLANFLKTIAMSGVDDVRSVLENYALEEDPIEAFKRRQAQLAQEEEQRLSELSQQKKQGLSIGSIASRFWRSKQQ",
"proteome": "UP000695023",
"gene": "timm50",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8df33b9b2c79564cda8ce6ea21c83f17a3ce11b7",
"counters": {
"domain_architectures": 32066,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32066
}
}
}