GET /api/protein/UniProt/A0A9X9M9W7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9X9M9W7",
"id": "A0A9X9M9W7_GULGU",
"source_organism": {
"taxId": "48420",
"scientificName": "Gulo gulo",
"fullName": "Gulo gulo (Wolverine)"
},
"name": "Peptidyl-prolyl cis-trans isomerase",
"description": [
"PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides"
],
"length": 58,
"sequence": "MKSCQFFICTANTEWRDGKHVVFDKMKEGVNFVEAIEYFGTRNGKTSKKIAIADCGRI",
"proteome": "UP000269945",
"gene": "BN2614_LOCUS4",
"go_terms": [
{
"identifier": "GO:0003755",
"name": "peptidyl-prolyl cis-trans isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000413",
"name": "protein peptidyl-prolyl isomerization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec13550bd3f45711d77ed9b599f14cde4aa876a9",
"counters": {
"domain_architectures": 108117,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 108117
}
}
}