GET /api/protein/UniProt/A0A9X7J3A8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9X7J3A8",
        "id": "A0A9X7J3A8_9FIRM",
        "source_organism": {
            "taxId": "1266720",
            "scientificName": "Neomoorella stamsii",
            "fullName": "Neomoorella stamsii"
        },
        "name": "Pyrophosphate--fructose 6-phosphate 1-phosphotransferase",
        "description": [
            "Catalyzes the phosphorylation of D-fructose 6-phosphate, the first committing step of glycolysis. Uses inorganic phosphate (PPi) as phosphoryl donor instead of ATP like common ATP-dependent phosphofructokinases (ATP-PFKs), which renders the reaction reversible, and can thus function both in glycolysis and gluconeogenesis. Consistently, PPi-PFK can replace the enzymes of both the forward (ATP-PFK) and reverse (fructose-bisphosphatase (FBPase)) reactions"
        ],
        "length": 410,
        "sequence": "MLKGNCVIAQSGGPTAVINNSLAGAIEAAYHGEAIGEIYGARNGIMGVLAENFIDLRRQDAATIQGLRFTPGAALGSCRYQLEKKEDYDKLLAIFRKFNIRYFFYIGGNDSMDTAHKVNQLAQEEGYELRVIGIPKTVDNDLPRTDHCPGYGSAAKYLAASVLEMGMDIKSIVTSTKVAIVEAMGRNTGWLAAATALARRAPGEAPHLIYLPEVAFDLDAFLADVETAYRQYGTVLVVVSEGLVDKNGNYIFNDAGTVDVFGHQRLGGLGQFLLNKIEAELKIKGRFILPATSQRSAMHLASRTDAEEAYNVGRVAVEEALRGASGHMVAIKRLEGEEYRCTYELVELDKVANQEKKVPRDWINAAGNDVTTDFINYARPLIQGEVNVPYHNGLPAYVNLAHQYPVKKCG",
        "proteome": "UP000239430",
        "gene": "pfkA1_1",
        "go_terms": [
            {
                "identifier": "GO:0003872",
                "name": "6-phosphofructokinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006096",
                "name": "glycolytic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0047334",
                "name": "diphosphate-fructose-6-phosphate 1-phosphotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006002",
                "name": "fructose 6-phosphate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c47239981a029609f58ab64a8107d57cef15dd9e",
        "counters": {
            "domain_architectures": 37322,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 2,
                "ncbifam": 1,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37322
        }
    }
}