HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9X3TTC4",
"id": "A0A9X3TTC4_9BACL",
"source_organism": {
"taxId": "33942",
"scientificName": "Brevibacillus thermoruber",
"fullName": "Brevibacillus thermoruber"
},
"name": "Protein translocase subunit SecE",
"description": [
"Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation"
],
"length": 71,
"sequence": "MGFLARIGAGFRRTGEFFGDVMSELKKVRWPNRKELTSYTIVVLVTVTLLALFFFVIDLGISRVIDLILGK",
"proteome": "UP001151071",
"gene": "secE",
"go_terms": [
{
"identifier": "GO:0008320",
"name": "protein transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009306",
"name": "protein secretion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006605",
"name": "protein targeting",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0d41e4e71441ccac4f46a43da1a097dd754b8912",
"counters": {
"domain_architectures": 28756,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28756
}
}
}