GET /api/protein/UniProt/A0A9W9W663/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W9W663",
        "id": "A0A9W9W663_9EURO",
        "source_organism": {
            "taxId": "1131564",
            "scientificName": "Penicillium cosmopolitanum",
            "fullName": "Penicillium cosmopolitanum"
        },
        "name": "Signal peptidase complex subunit 2",
        "description": [
            "Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Enhances the enzymatic activity of SPC and facilitates the interactions between different components of the translocation site"
        ],
        "length": 189,
        "sequence": "MASKVPVYSTNDLKSTTDDALLPYLCTLPAPYAFKVDHSKSNVRFALGYSAIAIAGFTFYADRTLGWEATSSPWIIAAVVAYFTLNSILTFWLWAVEAGEVFAGKRKTGETITVSSSSKKFSKEYKLRVQYKSPNGKVLQDKRCEAPFTTWFSGEGVFHAEPFRRWLSSEIDILRLAAKENEKKAAKDS",
        "proteome": "UP001147747",
        "gene": "N7509_004095",
        "go_terms": [
            {
                "identifier": "GO:0006465",
                "name": "signal peptide processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005787",
                "name": "signal peptidase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c77a7a23aba38fcdbd3dd11197dadfc688de5c94",
        "counters": {
            "domain_architectures": 4628,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4628
        }
    }
}