General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W9RD60",
        "id": "A0A9W9RD60_9EURO",
        "source_organism": {
            "taxId": "293559",
            "scientificName": "Penicillium concentricum",
            "fullName": "Penicillium concentricum"
        },
        "name": "Aprataxin-like protein",
        "description": [
            "DNA-binding protein involved in single-strand DNA break repair, double-strand DNA break repair and base excision repair. Resolves abortive DNA ligation intermediates formed either at base excision sites, or when DNA ligases attempt to repair non-ligatable breaks induced by reactive oxygen species. Catalyzes the release of adenylate groups covalently linked to 5'-phosphate termini, resulting in the production of 5'-phosphate termini that can be efficiently rejoined. Likewise, catalyzes the release of 3'-linked guanosine (DNAppG) and inosine (DNAppI) from DNA, but has higher specific activity with 5'-linked adenosine (AppDNA)"
        ],
        "length": 275,
        "sequence": "MSGEHSNPSKGEPKEQTGTSEKRNAFTELLAPKSKQPKHAAKTPSDRNAAKGKTAFGVRDGLGAYIAKPETYAPDVVVYHNDDFVAIHDMFPKSSLHLLLLPRDQTKTRMHPFDAFEDAAFLAKVKAETQTLRKLAAGELRRKYGKDSAQEQARQAALGADPPPDKLPQGRDWEQEIVVGVHAVPSMNHLHVHVLSVDRYSGRLKHRKHYNSFSTPFFVPIEDFPLAEDDVRRNPTKEGYLKRDFTCWRCGRGFGDRFAELKQHLEQEFKEWKKL",
        "proteome": "UP001147752",
        "gene": "N7517_011343",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "87c7147800769eacefa6dce634d18dfe4ea5554c",
        "counters": {
            "domain_architectures": 906,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 906
        }
    }
}