General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W6ZF97",
        "id": "A0A9W6ZF97_9STRA",
        "source_organism": {
            "taxId": "1606541",
            "scientificName": "Triparma strigata",
            "fullName": "Triparma strigata"
        },
        "name": "Peroxisomal trans-2-enoyl-CoA reductase",
        "description": [
            "Participates in chain elongation of fatty acids. Catalyzes the reduction of trans-2-enoyl-CoAs of varying chain lengths from 6:1 to 16:1, having maximum activity with 10:1 CoA. Has no 2,4-dienoyl-CoA reductase activity"
        ],
        "length": 287,
        "sequence": "MNTKPKTVFRPKLFDKKVALVTGGGTGIGFAIATELSLAGATVWISGRSEEKLDDAEKRHFKETGLRLLTQPCDIRNATDVDALTSEVLTKSGSIDILINNAGGQFPCSAEELSNKGFMAVVNLNLLGTFSMCREVFNKYMSTHGGSIANITLGMNNGMPLMAHSGAARAGVENMTKTLSQEWIASGVRINCVRPGIIYTESGFDNYKGLGDDVLNKIVRSIPAKRLGTAEEVASAAVFLSSDGARYITGQSLAVCGGQSFTHLAIFEQEDKVGLIPYGALPLKARL",
        "proteome": "UP001165085",
        "gene": "TrST_g8584",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff1cec7cb7eee88f7c3ec2b2277c3a1762c3bf68",
        "counters": {
            "domain_architectures": 518272,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 518272
        }
    }
}