HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9W5VHA6",
"id": "A0A9W5VHA6_BACCE",
"source_organism": {
"taxId": "1053215",
"scientificName": "Bacillus cereus ISP2954",
"fullName": "Bacillus cereus ISP2954"
},
"name": "Quinol oxidase subunit 2",
"description": [
"Catalyzes quinol oxidation with the concomitant reduction of oxygen to water. Subunit II transfers the electrons from a quinol to the binuclear center of the catalytic subunit I"
],
"length": 291,
"sequence": "MQLKKAFWKLASLLPLSLLLFLGGCDKKLAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGNTLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEEKIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLGRSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQETAPKLTEAKYNEIVKPGVVGRMTFSSHHLSYVDPKSLEYCDYNYYKNKK",
"proteome": null,
"gene": "IGU_06242",
"go_terms": [
{
"identifier": "GO:0022900",
"name": "electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004129",
"name": "cytochrome-c oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005507",
"name": "copper ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016682",
"name": "oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009486",
"name": "cytochrome bo3 ubiquinol oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fa2be46f18d0b31cd1a45654e867d305173db7a6",
"counters": {
"domain_architectures": 5922,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"ssf": 2,
"cathgene3d": 2,
"cdd": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5922
}
}
}