GET /api/protein/UniProt/A0A9W5KS96/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9W5KS96",
"id": "A0A9W5KS96_BACCE",
"source_organism": {
"taxId": "1053238",
"scientificName": "Bacillus cereus VD154",
"fullName": "Bacillus cereus VD154"
},
"name": "NADH-quinone oxidoreductase subunit J",
"description": [
"NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
],
"length": 174,
"sequence": "MNGEFVAFFILSLSAIIGGVLMLNLTKVMHMMLALVLTFLSIAGLYFLLSAEFIGVAQILLYSGAITIIMIFGIMLTKHNAENESRLTLRKWIIFFAVVAFGAVMYFAVNNVDFANESTQGSLPLHENNTLQIGTLLYSKYIIPFELTSVILLVALVGAIILAKKDEKEEDSNE",
"proteome": null,
"gene": "IK5_05459",
"go_terms": [
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "96cfd4c69773af29d548fde0c6c747d9cca5615a",
"counters": {
"domain_architectures": 51372,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ncbifam": 2,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 51372
}
}
}