General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W3PTI6",
        "id": "A0A9W3PTI6_9BACI",
        "source_organism": {
            "taxId": "1330043",
            "scientificName": "Bacillus bombysepticus str. Wang",
            "fullName": "Bacillus bombysepticus str. Wang"
        },
        "name": "Polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase TagU",
        "description": [
            "May catalyze the final step in cell wall teichoic acid biosynthesis, the transfer of the anionic cell wall polymers (APs) from their lipid-linked precursor to the cell wall peptidoglycan (PG)"
        ],
        "length": 304,
        "sequence": "MKKKILFWILGIIGVLIIGGGAYAYHVYSNISNTLDAVHKPLDREKSDKRSEKVDVADKKPISILLMGSDQRKDEIGRSDSLMLFTLNPKTKSMKITSIPRDSYTEIVGKGKKDKINHAYAFGGIDMAVKTVENFLNVPVDHYIEVNMAGFKDIVDAVGGVDINNDMDFTIDGVHYAKGDLHLNGDKALLYSRMRYQDPRGDFGRQMRQRQVIQAVIKKGASVSSLASYGDVLKAIEKNVKTSLTQDQMFDIQKNYKDCMQNSEEIQIPGDGHKAADGIWYYYVPDAAKQDLTNKLRAHLELTK",
        "proteome": "UP000031778",
        "gene": "tagU",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "89ee1d9c64a6b5b00198d2a340f4a91d09167662",
        "counters": {
            "domain_architectures": 33066,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33066
        }
    }
}