GET /api/protein/UniProt/A0A9W3JTI6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W3JTI6",
        "id": "A0A9W3JTI6_BACTU",
        "source_organism": {
            "taxId": "1217737",
            "scientificName": "Bacillus thuringiensis HD-789",
            "fullName": "Bacillus thuringiensis HD-789"
        },
        "name": "RQC P-site tRNA stabilizing factor",
        "description": [
            "Key component of the ribosome quality control system (RQC), a ribosome-associated complex that mediates the extraction of incompletely synthesized nascent chains from stalled ribosomes and their subsequent degradation. RqcH recruits Ala-charged tRNA, and with RqcP directs the elongation of stalled nascent chains on 50S ribosomal subunits, leading to non-templated C-terminal alanine extensions (Ala tail). The Ala tail promotes nascent chain degradation. RqcP is associated with the translocation-like movement of the peptidyl-tRNA from the A-site into the P-site"
        ],
        "length": 91,
        "sequence": "MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVADELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF",
        "proteome": null,
        "gene": "rqcP",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e2ef8307f6c8b472fa144fb8a66a56865a92d873",
        "counters": {
            "domain_architectures": 19596,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19596
        }
    }
}