GET /api/protein/UniProt/A0A9W3JTI6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9W3JTI6",
"id": "A0A9W3JTI6_BACTU",
"source_organism": {
"taxId": "1217737",
"scientificName": "Bacillus thuringiensis HD-789",
"fullName": "Bacillus thuringiensis HD-789"
},
"name": "RQC P-site tRNA stabilizing factor",
"description": [
"Key component of the ribosome quality control system (RQC), a ribosome-associated complex that mediates the extraction of incompletely synthesized nascent chains from stalled ribosomes and their subsequent degradation. RqcH recruits Ala-charged tRNA, and with RqcP directs the elongation of stalled nascent chains on 50S ribosomal subunits, leading to non-templated C-terminal alanine extensions (Ala tail). The Ala tail promotes nascent chain degradation. RqcP is associated with the translocation-like movement of the peptidyl-tRNA from the A-site into the P-site"
],
"length": 91,
"sequence": "MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVADELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF",
"proteome": null,
"gene": "rqcP",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e2ef8307f6c8b472fa144fb8a66a56865a92d873",
"counters": {
"domain_architectures": 19596,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cdd": 1,
"profile": 1,
"smart": 1,
"ssf": 1,
"cathgene3d": 1,
"hamap": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 19596
}
}
}