General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W3G5I5",
        "id": "A0A9W3G5I5_CAMBA",
        "source_organism": {
            "taxId": "9837",
            "scientificName": "Camelus bactrianus",
            "fullName": "Camelus bactrianus (Bactrian camel)"
        },
        "name": "Neural retina-specific leucine zipper protein",
        "description": [
            "Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Also functions as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds to the rhodopsin promoter in a sequence-specific manner"
        ],
        "length": 285,
        "sequence": "MMLIETEQNPVGPSQVHPSHSSPRMALPPSPLAMEYVNDFDLMKFEVKREPSEGRSGPATASLGSTPYSSVPPSPTFSDPGMAGATDSSRPGLEELYWLATLQQQLGAGEALGLSPEEAVELLQGQGPVPVEGSHTYYPGSPEETGAQHAQLAERFSDAVLVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLAPSCSEPEAIPTSSEPLAAEWWSRWAGGAPHPGGGCTIH",
        "proteome": "UP001732780",
        "gene": "NRL",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "84e0763b1d30f7a9e5e0ce19045c83ec54139187",
        "counters": {
            "domain_architectures": 2616,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "cdd": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "pfam": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2616
        }
    }
}