HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9W3F750",
"id": "A0A9W3F750_CAMBA",
"source_organism": {
"taxId": "9837",
"scientificName": "Camelus bactrianus",
"fullName": "Camelus bactrianus (Bactrian camel)"
},
"name": "Vesicle-trafficking protein SEC22b",
"description": [
"SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER"
],
"length": 215,
"sequence": "MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFKKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL",
"proteome": "UP001732780",
"gene": "SEC22B",
"go_terms": [
{
"identifier": "GO:0005484",
"name": "SNAP receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006888",
"name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006890",
"name": "retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e09a1477707fd7f9badcb09d6cf1d43f3f6a69d9",
"counters": {
"domain_architectures": 17217,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 2,
"profile": 2,
"smart": 1,
"pfam": 2,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17217
}
}
}