HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9W3F487",
"id": "A0A9W3F487_CAMBA",
"source_organism": {
"taxId": "9837",
"scientificName": "Camelus bactrianus",
"fullName": "Camelus bactrianus (Bactrian camel)"
},
"name": "Plasminogen",
"description": [
"Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1, C4 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells"
],
"length": 832,
"sequence": "MQVNDILGLGHTVFRTLLPSPKMEHKEVVLLLLLFLKSGLGDPLEDYVNTQGASLFSLTRKQLGAGSVDECARKCEEETSFICRAFQYHSKEQQCVIMAENSKSSPVLRMRDVVLFEKRIYLSECKTGNGKNYRGTMSKTKRGVTCQKWSNSSPHIPNYSPEKLPQAGLEENYCRNPDNDEKGPWCYTTDPNTRFDYCDIPECEDECMHCSGENYEGKISKTMSGLACQFWNSQSPHAHGYIPAKFPNKNLKMNYCRNPDGEPRPWCFTTNPNKRWEYCNIPRCTTPPPPSGPTYQCLKGRGENYRGVVAVTVSGHTCQRWSEQSPHKHNRTPEDFPCKNLDENYCRNPDGETSPWCYTTNKEVRWEHCKIPPCGSSPVSTEHLDAPVPPEQTPVVQDCYNGDGQSYRGTSSTTLTGRKCQSWSSMIPHRHQKTPENFPNAGLTMNYCRNPDADKSPWCYTTDPSVRWEYCNLRKCSNTEVLVTHSPAVGQVPNAEAPSEADCMLGNGKGYRGKKATTVAGVPCQEWAAQEPHRHRIFTPETNPRAGLEKNYCRNPDGDVNGPWCYTTNPLKLFDYCDVPQCVSSSFDCGKPKVEPKKCSGRVVGGCVSNPHSWPWQVSLRTRFLKHFCGGTLISPEWVLTATHCLERSSRPTSYKVILGAHQEVNLEADVQELEVSKLFRGPQGADIALLKLSSPAIITDKVIPACLPSPNYVVADQTVCYITGWGETQGTSKAGPLKEAQVPVIENKVCNRYEYLDGRVRSSELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVPWIEEIMRNN",
"proteome": "UP001732780",
"gene": "PLG",
"go_terms": [
{
"identifier": "GO:0004252",
"name": "serine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "44ee1823043c9ebddf49034593d3fa34d8e059a7",
"counters": {
"domain_architectures": 1149,
"entries": 37,
"isoforms": 0,
"proteomes": 1,
"sets": 6,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"smart": 3,
"profile": 3,
"pfam": 3,
"cdd": 3,
"pirsf": 1,
"panther": 1,
"prosite": 3,
"prints": 2,
"interpro": 12
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1149
}
}
}