GET /api/protein/UniProt/A0A9W2V9Z1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W2V9Z1",
        "id": "A0A9W2V9Z1_PANPR",
        "source_organism": {
            "taxId": "9691",
            "scientificName": "Panthera pardus",
            "fullName": "Panthera pardus (Leopard)"
        },
        "name": "Cyclin-dependent kinase inhibitor 1C",
        "description": [
            "Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life"
        ],
        "length": 176,
        "sequence": "MERLVARRTFPLFARTSACRSLFGPVDHEELSRELQIRLAELSAEDQRRWDYNFQQDVPLRGPGRLQWTEVDSDSVPAFYRETVQISSPSARDPRPRPRRRTRSPRDAPPLAPLRPWARRSRPRASDCDEPRAQRAPREPAGQRTGQERWASAGTVHVAATGGSCHRAAFGFMFKI",
        "proteome": "UP001165780",
        "gene": "CDKN1C",
        "go_terms": [
            {
                "identifier": "GO:0004861",
                "name": "cyclin-dependent protein serine/threonine kinase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051726",
                "name": "regulation of cell cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "49fe8166a033d4e3f8d957ec9dd191a1ccb2c0e4",
        "counters": {
            "domain_architectures": 7200,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7200
        }
    }
}