GET /api/protein/UniProt/A0A9W2V9Z1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9W2V9Z1",
"id": "A0A9W2V9Z1_PANPR",
"source_organism": {
"taxId": "9691",
"scientificName": "Panthera pardus",
"fullName": "Panthera pardus (Leopard)"
},
"name": "Cyclin-dependent kinase inhibitor 1C",
"description": [
"Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life"
],
"length": 176,
"sequence": "MERLVARRTFPLFARTSACRSLFGPVDHEELSRELQIRLAELSAEDQRRWDYNFQQDVPLRGPGRLQWTEVDSDSVPAFYRETVQISSPSARDPRPRPRRRTRSPRDAPPLAPLRPWARRSRPRASDCDEPRAQRAPREPAGQRTGQERWASAGTVHVAATGGSCHRAAFGFMFKI",
"proteome": "UP001165780",
"gene": "CDKN1C",
"go_terms": [
{
"identifier": "GO:0004861",
"name": "cyclin-dependent protein serine/threonine kinase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051726",
"name": "regulation of cell cycle",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "49fe8166a033d4e3f8d957ec9dd191a1ccb2c0e4",
"counters": {
"domain_architectures": 7200,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7200
}
}
}