General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9R1T6V2",
        "id": "A0A9R1T6V2_9HYME",
        "source_organism": {
            "taxId": "64838",
            "scientificName": "Fopius arisanus",
            "fullName": "Fopius arisanus"
        },
        "name": "Polyprenal reductase",
        "description": [
            "Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol. Acts as a polyprenal reductase that mediates the reduction of polyprenal into dolichal in a NADP-dependent mechanism. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation"
        ],
        "length": 302,
        "sequence": "MDVNLTKLTFIFMASSVGFVGFLMHAIDDYMPLLIRKTFRYGKFAEKKDHMLVNRLELPKRWFSHFYLFAAPAASISLIIVVNRYFFSGQLPKIVRWLLNFQLGSSRKSLVPAEKCFTAIFLITIQCWKRLYETTRVSVFSNAKINISHYIVGYIHYIGTLTCILGESEGFINASQISFHWSNLTYLDYSCAFGFLSASYLQLLSNYILSNLRKDGKGAVVTKSYKIPRGGLFNYVTGALQFTEITMYFMLTIILWRSSTYHYVFLWVVINQIQTAVDSDRWYRIYFKDYPENRKICIPFIF",
        "proteome": "UP000694866",
        "gene": "LOC105267066",
        "go_terms": [
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043048",
                "name": "dolichyl monophosphate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "249a07fa23f546641bf50c576f6f83b8fb8dadf3",
        "counters": {
            "domain_architectures": 12867,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12867
        }
    }
}