General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9R1QGN6",
        "id": "A0A9R1QGN6_TRITD",
        "source_organism": {
            "taxId": "4567",
            "scientificName": "Triticum turgidum subsp. durum",
            "fullName": "Triticum turgidum subsp. durum (Durum wheat)"
        },
        "name": "Fe2OG dioxygenase domain-containing protein",
        "description": null,
        "length": 392,
        "sequence": "MALEGPAERRDEGQQGGMANGNGVAPPPSRMAGRPLGAAAYSDRRLRLNPNTEHKPQDYTDVRGEYAPAVYSALERHLPPSLLEADRDVKLHFMRDILARYWPHGERNKVHRHKEYRQKIVHLYKPLHQELYSMHPSAFFLPTFLEAVRTNTEESIASIMTEPIAGVFSFAMLQPNFCDMLLEEVENFEKWVHAMKFKIMRPNTMNKYGAVLDDFGLEAMLNQFMEEFIAPISKVFYPEVGGGTLDSHHAFVVEYGKDRDVELGFHVDDSEVTLNVCLGKQFSGGELYFRGIRCENHVNSETQHEEMYDYSHVPGRAVLHRGRHRHGARPTSSGLRMNLLLWCRSSVFREMKKYQMGFSSWCGECQREKRERQIQCVKATKAFLRGAGGAMI",
        "proteome": "UP000324705",
        "gene": "TRITD_3Bv1G113680",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0031418",
                "name": "L-ascorbic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "60818e16efa25a727120bd0cdc8195e3f759c861",
        "counters": {
            "domain_architectures": 2780,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "smart": 1,
                "cathgene3d": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2780
        }
    }
}