GET /api/protein/UniProt/A0A9Q9W9I7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Q9W9I7",
"id": "A0A9Q9W9I7_CYPCA",
"source_organism": {
"taxId": "7962",
"scientificName": "Cyprinus carpio",
"fullName": "Cyprinus carpio (Common carp)"
},
"name": "Apolipoprotein A-I",
"description": [
"Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT)"
],
"length": 197,
"sequence": "MKFVALALTILLAVGSQAHFLQADAPSQLEHYKAAALVYLTQVKEQAQKALDNLDGTDYEQYKVQLSESLTKLQDYAQSTSQTLTPYAETISNQFLENTNQLRERVMTDIEGLRSKMEPHRAELYGVLQKHFDEYREKLEPFLQEYANLNRENADQLRAKLQPLLEEMRQNFETNLEETKSKLVPMGTHCASVWLHL",
"proteome": null,
"gene": "LOC122137354",
"go_terms": [
{
"identifier": "GO:0008289",
"name": "lipid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006869",
"name": "lipid transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042157",
"name": "lipoprotein metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0f689dbae454f053963913a5f4bb471330d88593",
"counters": {
"domain_architectures": 3600,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3600
}
}
}