HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Q9BTJ5",
"id": "A0A9Q9BTJ5_9STAP",
"source_organism": {
"taxId": "69967",
"scientificName": "Macrococcus equipercicus",
"fullName": "Macrococcus equipercicus"
},
"name": "3-hexulose-6-phosphate synthase",
"description": [
"Catalyzes the condensation of ribulose 5-phosphate with formaldehyde to form 3-hexulose 6-phosphate"
],
"length": 209,
"sequence": "MKLQLALDLVDIQGAIEVIKEVEAYVDVVEIGTPVVINEGLRAVKEVKAAFPNMTVLADLKIMDAAGYEVSQAAAAGADIITILGAAEDESIKGAVKEAKAQGKEILVDMIAVSDIATRAKELDALGVDYICVHTGYDLQAVGKDSFEDLATIKSVVTNAKTAVAGGIKLETLPEVIKQQPDLIIVGGGITSQDDKKETARQMQELISK",
"proteome": null,
"gene": "hxlA",
"go_terms": [
{
"identifier": "GO:0004590",
"name": "orotidine-5'-phosphate decarboxylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006207",
"name": "'de novo' pyrimidine nucleobase biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043801",
"name": "hexulose-6-phosphate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bfa259cb295edeb275c86a7b575c2fbeb1ad6dbe",
"counters": {
"domain_architectures": 35089,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cdd": 1,
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 35089
}
}
}