GET /api/protein/UniProt/A0A9Q7WHP2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9Q7WHP2",
        "id": "A0A9Q7WHP2_9MYCO",
        "source_organism": {
            "taxId": "319705",
            "scientificName": "Mycobacteroides abscessus subsp. bolletii",
            "fullName": "Mycobacteroides abscessus subsp. bolletii"
        },
        "name": "Small ribosomal subunit protein uS7",
        "description": [
            "One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA"
        ],
        "length": 156,
        "sequence": "MPRKGPAPSRPLVNDPVYGSQLVTQLVNKVLLDGKKSIAERIVYGALEQARDKTGTDPVVTLKRAMDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVTFSRARREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW",
        "proteome": null,
        "gene": "rpsG",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b38a96b66a03eafcff49a4d98ca22b5cde0cd722",
        "counters": {
            "domain_architectures": 57558,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 57558
        }
    }
}