General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9Q6V3E8",
        "id": "A0A9Q6V3E8_ECOLX",
        "source_organism": {
            "taxId": "1055538",
            "scientificName": "Escherichia coli O145",
            "fullName": "Escherichia coli O145"
        },
        "name": "Mannitol operon repressor",
        "description": [
            "Involved in the repression of the expression of the mannitol mtlADR operon. Does not bind the operator/promoter regulatory region of this operon. Therefore, seems to belong to a new class of transcription factors in bacteria that may regulate gene expression indirectly, perhaps as a part of a larger transcriptional complex"
        ],
        "length": 195,
        "sequence": "MVDQAQDTLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNLLVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREELNHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRSTMVLSLTELISRISLKKAFQK",
        "proteome": null,
        "gene": "mtlR",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "058d87b3d31cffe0546afb5606ffd38a86ffd6ec",
        "counters": {
            "domain_architectures": 2011,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2011
        }
    }
}