GET /api/protein/UniProt/A0A9Q6V3E8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Q6V3E8",
"id": "A0A9Q6V3E8_ECOLX",
"source_organism": {
"taxId": "1055538",
"scientificName": "Escherichia coli O145",
"fullName": "Escherichia coli O145"
},
"name": "Mannitol operon repressor",
"description": [
"Involved in the repression of the expression of the mannitol mtlADR operon. Does not bind the operator/promoter regulatory region of this operon. Therefore, seems to belong to a new class of transcription factors in bacteria that may regulate gene expression indirectly, perhaps as a part of a larger transcriptional complex"
],
"length": 195,
"sequence": "MVDQAQDTLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNLLVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREELNHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRSTMVLSLTELISRISLKKAFQK",
"proteome": null,
"gene": "mtlR",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "058d87b3d31cffe0546afb5606ffd38a86ffd6ec",
"counters": {
"domain_architectures": 2011,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2011
}
}
}