GET /api/protein/UniProt/A0A9Q4ENL4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Q4ENL4",
"id": "A0A9Q4ENL4_9BACI",
"source_organism": {
"taxId": "260554",
"scientificName": "Bacillus halotolerans",
"fullName": "Bacillus halotolerans"
},
"name": "Replication initiation control protein YabA",
"description": [
"Involved in control of chromosome replication initiation. Inhibits the cooperative binding of DnaA to the oriC region, thus negatively regulating initiation of chromosome replication. Inhibits the ability of DnaA-ATP to form a helix on DNA; does not disassemble preformed DnaA-DNA helices. Decreases the residence time of DnaA on the chromosome at its binding sites (oriC, replication forks and promoter-binding sites). Tethers DnaA to the replication machinery via the DNA polymerase beta sliding clamp subunit (dnaN). Associates with oriC and other DnaA targets on the chromosome in a DnaA-dependent manner"
],
"length": 119,
"sequence": "MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIEKFKADKKESKTQKTEQADIGEGYDNLARLYQEGFHICNVHYGSVRKEDCLFCLSFLNKK",
"proteome": "UP001164713",
"gene": "yabA",
"go_terms": [
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8ad5dfb5942c9200b8617598cd4326371f53bae3",
"counters": {
"domain_architectures": 2890,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2890
}
}
}