General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9Q4ENL4",
        "id": "A0A9Q4ENL4_9BACI",
        "source_organism": {
            "taxId": "260554",
            "scientificName": "Bacillus halotolerans",
            "fullName": "Bacillus halotolerans"
        },
        "name": "Replication initiation control protein YabA",
        "description": [
            "Involved in control of chromosome replication initiation. Inhibits the cooperative binding of DnaA to the oriC region, thus negatively regulating initiation of chromosome replication. Inhibits the ability of DnaA-ATP to form a helix on DNA; does not disassemble preformed DnaA-DNA helices. Decreases the residence time of DnaA on the chromosome at its binding sites (oriC, replication forks and promoter-binding sites). Tethers DnaA to the replication machinery via the DNA polymerase beta sliding clamp subunit (dnaN). Associates with oriC and other DnaA targets on the chromosome in a DnaA-dependent manner"
        ],
        "length": 119,
        "sequence": "MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIEKFKADKKESKTQKTEQADIGEGYDNLARLYQEGFHICNVHYGSVRKEDCLFCLSFLNKK",
        "proteome": "UP001164713",
        "gene": "yabA",
        "go_terms": [
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ad5dfb5942c9200b8617598cd4326371f53bae3",
        "counters": {
            "domain_architectures": 2890,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2890
        }
    }
}