HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Q2CXS0",
"id": "A0A9Q2CXS0_9STAP",
"source_organism": {
"taxId": "489910",
"scientificName": "Nosocomiicoccus ampullae",
"fullName": "Nosocomiicoccus ampullae"
},
"name": "Porphobilinogen deaminase",
"description": [
"Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps"
],
"length": 307,
"sequence": "MKTVVVGTRRSGLAKTQTLQLIESLKKKNPDVNFEVKEIVTKGDRIVDRQLSKVGGKGLFVKEIEHALKVGDIDMAVHSLKDVPSELPEGFKLSAVPIREDRRDAFLSNDNIPFKELPAGAIVGTSSLRRAAQLQELRDDITVNWVRGNIDTRIQKMRDGEYDAIILAAAGLKRMGWSDDIVTEYFDPEEFVPAVAQGALGVEIRDDDREVHEILSTIHDEVTATETTAERTFLKRMDGSCQVPIGASAQFVDDEIYLTGLIMSEDGNEKYLVKKSNDDPVALGNLVADEMEKMGAKEIIDEINKNK",
"proteome": "UP000579136",
"gene": "hemC",
"go_terms": [
{
"identifier": "GO:0004418",
"name": "hydroxymethylbilane synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033014",
"name": "tetrapyrrole biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0018160",
"name": "peptidyl-pyrromethane cofactor linkage",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "30b0f62cf65d567a5a8d6dbc0db3c483cee2ef42",
"counters": {
"domain_architectures": 26807,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 1,
"pfam": 2,
"cathgene3d": 2,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26807
}
}
}